SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si011716m|PACid:19696607 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si011716m|PACid:19696607
Domain Number 1 Region: 59-110
Classification Level Classification E-value
Superfamily F-box domain 0.00000000051
Family F-box domain 0.0063
Further Details:      
 
Domain Number 2 Region: 186-387
Classification Level Classification E-value
Superfamily RNI-like 0.00000353
Family Cyclin A/CDK2-associated p19, Skp2 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si011716m|PACid:19696607
Sequence length 513
Sequence
MALHDQAPPITLDRARSIARIHGQDPQELEPQFGFVLAHIHNALPAPPAAAAAAARLSAQ
LDPGDGIDRVSGLPDALLRDIVSRLPVKDAARTAALSRRWRPLWRAAPLVLLDNHLLPDG
AAPDDEIPNIYLEHADSRAVATALSCVLDAHPGPFRWVRLASCYMDEERGQVARWLQHLA
VKGVQELFLINRPWPLAVDLPVPTAFFSMAALTRLYLGFWKFPDTAGLPRGAAFPHLREL
GLCDVVIDNHDMDFVLARSPVLEILCFESHMLPPLRLRLVSRSLRCVQMHASNVESIVVV
DAPRLERLFVRFVPIEVPWCRIKIVCAPALRLLGRLDPAMHELQVGNTTIKILDVNVRFE
VRSDVKMLPSFLRCFPNIEKLHIHSQKTRESTGRLSIKFWQESGPIECIHTHINMIVFHD
FRGERSELAFLKFFIESAQMLNRLLIVFGKGCFSSMATSKLKALFAGKRANKHCSLLVCE
TAFSESSCLWDFQRGSDFSCTDPFAPVEHLSPE
Download sequence
Identical sequences K3YBX2
Si011716m|PACid:19696607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]