SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si011753m|PACid:19693978 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si011753m|PACid:19693978
Domain Number 1 Region: 7-52,91-137
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000118
Family F-box domain 0.0069
Further Details:      
 
Weak hits

Sequence:  Si011753m|PACid:19693978
Domain Number - Region: 346-491
Classification Level Classification E-value
Superfamily Tricorn protease N-terminal domain 0.051
Family Tricorn protease N-terminal domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si011753m|PACid:19693978
Sequence length 518
Sequence
METTTEVAALPSDALSHVFCRLPARSLAEARSVCKAWRAIVDARALLLRRRKLLPHNVHG
VFVNYIDHCRPHLFSRPSPVASSASYDKINNMLGFLPTYNNGDWWSVLDHCRGLVLCDIE
QGCQLCVCNPATQRWALVPPRWQARARWRSYVSAYLTFDPAMSPHYEVILIPTVLEWPQP
EPPGLQKARNQRRAFEVRLHGVDDAPFCLDEWLHFSSDVDEEEEEEGLGDEDMELSHVED
TCHLTEWPPTPWTLDVFSSRVGRWEERAFVRQGEPAGTVQDMLLDQPKPTCRGPRQRYAA
YWQGALYVHCRGSFIARLSLLNNNYQVIKTPGDIQKNTSAKPYLGISEKGVYFGIAQKCQ
LRVWILNESRGQMEWILKYEDDLTHYAQHVRQYDGQMDGPWIVHDVNDTDSVSEAMKQSS
EWDSDSDDIFTIKAGSTDEEYYGAGYDILGFHPYKEVVFLADYFTVVAYHLKTSKVRYLG
NSRPKSYYHSFTNDIYESFVYTPCMIGELNRGSTMKEN
Download sequence
Identical sequences K3YC09
Si011753m|PACid:19693978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]