SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si011837m|PACid:19696996 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si011837m|PACid:19696996
Domain Number 1 Region: 13-50
Classification Level Classification E-value
Superfamily F-box domain 0.0000501
Family F-box domain 0.0049
Further Details:      
 
Weak hits

Sequence:  Si011837m|PACid:19696996
Domain Number - Region: 142-268
Classification Level Classification E-value
Superfamily Fucose-specific lectin 0.00654
Family Fucose-specific lectin 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si011837m|PACid:19696996
Sequence length 364
Sequence
MARVEDGGGGGCFALNDDLLLHIFASYLDDTADLLRCAATCRRGRRLVASEAGFITCRRK
PPSEDDRLVNALAVGSEARLQLEPASGIPPAPPLLPAPQPKATVLPSADMPEHYACARLA
TADLDGAAVHPLLRPGSAAFRIVVVYKRGKDTMCRSYSADAESWGAEGELSGPNISSRLL
GYMGAGGVAVGGSVFWLSGDRVVFGLRLDTLQGRVESPKWYRMHRFSFAHPYPDRRLVVL
PDGKLGLVQVGQGDAGNLVMNVFSGSDYEKTRHRSGYWRERRWDWENVGLDALLPSSVVS
GAVKRMRLRSITEQDPALYALDLEKKKVQLMPVRPESCCFRRSSCSFQGCDNMDLVAYLT
SLGA
Download sequence
Identical sequences K3YC93
Si011837m|PACid:19696996

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]