SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si011918m|PACid:19695019 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si011918m|PACid:19695019
Domain Number 1 Region: 126-246,363-391
Classification Level Classification E-value
Superfamily RNI-like 0.000000275
Family 28-residue LRR 0.049
Further Details:      
 
Domain Number 2 Region: 27-72
Classification Level Classification E-value
Superfamily F-box domain 0.0000615
Family F-box domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si011918m|PACid:19695019
Sequence length 501
Sequence
MEQERTQPATKRARPSSPPQARAADAEDRLSALDDATLHAILARVPLRDAAVTAALSRRW
PRVFATLPRLVIRPATFNRRGFPDEGDEDRCEDPRRWMDALRRVLDGRAAPVAALEIDSR
FMSVHCNWFNKVFRELCCNGGLLELSIVNTDYTECYALPSTVYACTTLTSLDLYNCWLRL
SGSLVGLRPLRLLRLRNVTATDAELCRLIRRGSTMEHLEIHDVHKARNIIIEAPCLKKLY
IYSYRPLCIVVKKAPPLDMVKLSLSYGCPEHSWSLHDTKDIDRDYSIHEMEEMLDYKKMA
EREHKQTDEIKNMVKFLCGVSSTKSLRLHLSTEYSEVVSMSKASIPKSLPKKSYLLGLKS
LSLILDHNHEVLSTFVSCLLNSCPNLKDLRIIELRHPGSPAPLPAEFWFEKINGGGFLYR
LSSVTFYTDSLFEGHPCGGICKFLVMNAITLKKMSIKYHHSQVKPEHAAKLEAARRELRA
WPRASDHVLLELTPIDYFPSF
Download sequence
Identical sequences K3YCH1
XP_004978380.1.39314 Si011918m|PACid:19695019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]