SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si011926m|PACid:19693954 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si011926m|PACid:19693954
Domain Number 1 Region: 5-46
Classification Level Classification E-value
Superfamily F-box domain 0.0000628
Family F-box domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si011926m|PACid:19693954
Sequence length 363
Sequence
MPPTTDDAGESQWSELPPDLLRDISGRLHAAADFVRFRAVCRPWGESLADRPPNFLPWLL
APSDAGVDLEDQRCRCVFSRTSCRAPGICIRDRRVVRRRYTGRRMPDHTHSVVSGDDTIL
VYEFTPHPPGKVERFLSDFEGAILCPDDECPDHEPWMNVRSNLFTDRCCAAVYNRGDVVC
SDLANCYVLWKTVHSYVNNCHCRTTVTTRAALPDEPGKVRRCSYLLESRGGDEHELLLAS
VLKEAAGGGDLSVSVHALERRTGGEEPVVGWSRRDNDMGMLGDDVLFLGFPGSFAVDAAR
FGGEVSGGTAYFVIGDNSGGQTEPCSVYRYSFHDGAATLVETLPPGWHDARCMWFLPYPE
ISP
Download sequence
Identical sequences K3YCH8
Si011926m|PACid:19693954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]