SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si012007m|PACid:19696857 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si012007m|PACid:19696857
Domain Number 1 Region: 15-68
Classification Level Classification E-value
Superfamily F-box domain 0.00000011
Family F-box domain 0.009
Further Details:      
 
Domain Number 2 Region: 162-335
Classification Level Classification E-value
Superfamily RNI-like 0.0000298
Family 28-residue LRR 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si012007m|PACid:19696857
Sequence length 424
Sequence
ANQLRPSADFKDGAATAGVDLTGGLSDDVLVRVLELIPDARDLVRTGALSRRWRGLWTRV
PALRFASSARPEFASSVAERYAAFVSDALALRAAQTEPAVERLAISFAALASPSIIFRAA
EAWVQYAVDHALNPSTATLETTRLAIDHAIVKLPETAVFASLTDLSLERMGVEIGSGHLL
ARLLSPACCPRFRKLKLRKLRFRLAGFQELLLLEAGTLSELSFEDMVEPGVLQLRTPNLR
VLRINHSCLNELVISHAPRLEILMIDGLPDRIDVDGDLPRVSEVIKGRIPHLPNATSLTV
QISQFELHSFGNGVSDILAQCNNLKYLCLDLNCFIADLQRKNPKLDLTCHHQDHWKTHEI
SLVHLKEVELKGLTGTNCELWFMQSVISSARDLENPAASSSAPSTLPLPQRHRRSKPTPA
AAPP
Download sequence
Identical sequences K3YCQ8
Si012007m|PACid:19696857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]