SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si012103m|PACid:19694247 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si012103m|PACid:19694247
Domain Number 1 Region: 18-77
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000785
Family F-box domain 0.0046
Further Details:      
 
Domain Number 2 Region: 158-393
Classification Level Classification E-value
Superfamily RNI-like 0.000000000259
Family 28-residue LRR 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si012103m|PACid:19694247
Sequence length 429
Sequence
MEAPGKRKRGNDAGDAAAGYSSGDDRDRLSALPDSLIHHIMSFMKARQVVQTCVLSTRWR
HLWRSMTCLDVDKSEFETPGAKKYLDYEGWEKFEDFMDTLLSPGNVSIASLDTLRLQASY
GIGEGRPASRWIRRGIKYPHGQLPAAGVHRGKVVSYNSWRLRRLHLSNIELCDLFAEHVR
TSCQSLEDLELGSCSCKFHAIASGSLKNLALKYCTLYGLDEIATPTLKNLLIESGTGTNL
KTMDRPLVITAPALASMFLGVTPHNFVGGLSLSEMTSLAKVSVHLSCKEIVDPFKILGSC
VSSVITNLEVLGEGSTTFIQFNNLRTLVLSHCDLSDDFQILGHFLRNSPNLERLTLLYCK
YSNDTKKKKGPSKSKNAEYTPCPNLVDVPCKNLKLTHIIYKEDDIRQLIELLLHISGNLP
NNYIKLTKA
Download sequence
Identical sequences K3YD01
Si012103m|PACid:19694247

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]