SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si012129m|PACid:19695752 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si012129m|PACid:19695752
Domain Number 1 Region: 86-309
Classification Level Classification E-value
Superfamily RNI-like 0.00000000000171
Family Cyclin A/CDK2-associated p19, Skp2 0.034
Further Details:      
 
Domain Number 2 Region: 5-44
Classification Level Classification E-value
Superfamily F-box domain 0.0000000379
Family F-box domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si012129m|PACid:19695752
Sequence length 345
Sequence
RCRTDLLHAIMSFLPVRQAVQTCVLSRRWEHLWCSMPCLNIDQPEFKARGGSQFEEFVNN
LLMFHSATSLDMFRFRFACGYQFKVVERWIRRAMKCCPAVMEIYSSSGLFHRLPHLGSSA
CRLKKLHLVAISLDESFTQQLPSGCPVLEDLELNKCHLHSPEIKSYTLKNLIITGCTTYS
GRVLTITAPALVSFYLVITVVEWNSDYGVLVNEMPALVKAKVCLESSSPEGPCKLLCSLT
NVRNLELSGLETLSILRGTSDTFPTFSNLRTLLFNGCDLSDDFGMLGCFLNNSYSLEKLT
LEHCKCPNLKLTEIKYKEDDVHQLFGLLSGIWRNLQKTTIMLTKA
Download sequence
Identical sequences K3YD26
Si012129m|PACid:19695752

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]