SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si012232m|PACid:19696714 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si012232m|PACid:19696714
Domain Number 1 Region: 64-108
Classification Level Classification E-value
Superfamily F-box domain 0.000000000068
Family F-box domain 0.0071
Further Details:      
 
Domain Number 2 Region: 190-280,355-403
Classification Level Classification E-value
Superfamily RNI-like 0.00000196
Family 28-residue LRR 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si012232m|PACid:19696714
Sequence length 530
Sequence
MAGQAQPSTMHQDVLRVADSGGMDPQELEALFDRVLSSIHDALPAPPVSADGDLCILFDA
EGGGVDRLSCLPDKLLCDIVSRLPIKDAARTAVLSRRWRPIWRAAPLVLVDTHLLPAGDD
EIPVHLDRAHSNTVAATVSRIFAAHPGPFRCVRLTCCYMEEDRAQLERWLKIFAVKGIEQ
LFLINRPWPLAINKHLPATFLSMATLTRLYLGFWRFPDTSALPRGAAFPCLRELALCGIV
MDSRDMDFVLARSPVLEILSVDGHMLPPLRLRIVSHSLRCMQIHSSSVESVTVVDARRLE
RLFLGKRTNESSSFKIKIGHAPALRMFGSIELENEELQVGNTTVKAGTVVNSSVMVPSVT
TLDVNVRFGVRNDTKMLPSILRCFPNIEVLHIHSKKTTESTGRLGIKFWQESCAIKCVLS
SINMLSFYDFRGERNELAFLKFFVESAQMLKILVVVYANGYCSSRDKANSKVKALFAGKR
ANDSCKVVVCESRFSEGGRCWELQRGCDFSFDDPFGLIGCSSFGVHQWSV
Download sequence
Identical sequences K3YDC8
Si012232m|PACid:19696714

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]