SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si012317m|PACid:19697169 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si012317m|PACid:19697169
Domain Number 1 Region: 20-77
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000746
Family F-box domain 0.0073
Further Details:      
 
Weak hits

Sequence:  Si012317m|PACid:19697169
Domain Number - Region: 133-207
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0863
Family Quinoprotein alcohol dehydrogenase-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si012317m|PACid:19697169
Sequence length 297
Sequence
MRPPHTPPAKCRRLTASCPSIPEDILVTEVLARLPVRSLFRFRSVCQSWRAAIDGDPRFV
CRHLELSRGRSPPSVLDAPCEPRLEDYLGVARSKEMEFRRIRHGGVRHGGETAAAVDAEL
MHAVVWPTNRFTAMTHPVHCDGVVLVPTASGELFVCNPATRVLVQLPPGSPSVMADAVAF
GFDPSSNTYKVARTFHRRFEVIEYDSESDDDGEGYPRAEFDIGHEVFTLGAGSSDWEPTE
DPPHFIIPTARPICTRGAFYWTAVVGCPDDPRPSELLRFCLRDETFTVVSPTLRASR
Download sequence
Identical sequences K3YDL2
Si012317m|PACid:19697169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]