SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si012351m|PACid:19697367 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si012351m|PACid:19697367
Domain Number 1 Region: 1-75
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000676
Family F-box domain 0.012
Further Details:      
 
Weak hits

Sequence:  Si012351m|PACid:19697367
Domain Number - Region: 83-139
Classification Level Classification E-value
Superfamily C-terminal domain of adenylylcyclase associated protein 0.00222
Family C-terminal domain of adenylylcyclase associated protein 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si012351m|PACid:19697367
Sequence length 231
Sequence
MDRLPEDVLGEVLRRIPPHSLAVCRCVCSAWRAAVDIRRLLLPHVLPHSVLDHCNGLILF
GYDHRRNLYVCNPATRRLPLLDNKYQVIKTPPTTNIEESKHINPYLGRSENGVHYATVKK
RELQVWALDESGGHKEWELKYHVNLDVLTCQIQSLRCYLEQLNRPWTISDSDDEDEMGGL
EADSDDEDVEEDQPVKNGSIRPNGYYGSTTSLYESFIYTPCLVDSLTENDH
Download sequence
Identical sequences K3YDP5
Si012351m|PACid:19697367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]