SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si012393m|PACid:19697339 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si012393m|PACid:19697339
Domain Number 1 Region: 60-104
Classification Level Classification E-value
Superfamily F-box domain 0.00000000017
Family F-box domain 0.0078
Further Details:      
 
Domain Number 2 Region: 173-299,368-394
Classification Level Classification E-value
Superfamily RNI-like 0.000000298
Family 28-residue LRR 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si012393m|PACid:19697339
Sequence length 524
Sequence
MANFTPPFPLDRDARRRGEDPQEMEALFGRVLSYIYHALPDPPVTADGDLCILFDDDGGG
IDRLSLLPDTLLGNIVSRLPIKDAARTAVLSRRWRPIWRATPLVLLDTHLLPGGDDVIPN
HLDRASSSAVVAAVSRILDAHPGPFCCVRLTCCYMDEHRAPFARWLKLFAVKGVKELFLI
NRPWPLEAKTPIPATLFSMAELNTLYLGFWMFPDTTGLLRGAAFPRLRELGLCSVYIDAW
DIEFVLSRSPVLEILSFEGLFLPLRLRLVSNSLRCLQVHSCKLDSLTVVDAPRLERLFLR
TYESEGLKNRIKIAHAPALLLFGNFELGKDELQIGRTIVKARTGADPSATITSVKTLDVD
VRFGIRSDAKMLLIILRCFPNLERLHIHSKNTTESTGRLNIKFWQESGAIKCVLSRIAVM
AFHDFRGERNEIAFLKFVIESAPMLRMLMIVYANGYFGSRDEATSKTKALFAGKRANDHC
LLAVCENMQADGGLWNFQKGSDFSCRDPFGIVQCSSFGVGHWYV
Download sequence
Identical sequences K3YDT5
Si012393m|PACid:19697339

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]