SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si012433m|PACid:19695514 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Si012433m|PACid:19695514
Domain Number - Region: 148-225,256-392
Classification Level Classification E-value
Superfamily DPP6 N-terminal domain-like 0.00392
Family DPP6 N-terminal domain-like 0.033
Further Details:      
 
Domain Number - Region: 5-43
Classification Level Classification E-value
Superfamily F-box domain 0.00736
Family F-box domain 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si012433m|PACid:19695514
Sequence length 452
Sequence
MPAGAPIRPWADLEPGLVSTIADCCALKDYASCRVVCAAWRSALPPPLSRPLTVLPADDA
ASLPVSLAACSLHARRWSRLLLHRPGGRVGAAARCRCVGASRDGWVALVAGDAAAPAGPM
LFNPFTGEEIPLDESLYQPAHGQLAPKIIFSPNPTRRDFIAASLIRPNMVAVQRAANGCS
YSEDTGPLLDGVVLVDIAYGDDGKVYCLAWDGEVHVLHLTRRHRVCRQMPPMEVGPLPKL
PIGADAFPPPYDVISEYTDGKNLVLCEGGLYQVWRRSSGSGSVTVDAPPGGAARRIRIFE
GDVFVLRYDPGNWPGSCWTVADAKDLRGNAVFVGMNDAAVVRGEGVSANSVYYWDGPRGG
DGDYEAVVYNVATKASVRWPAASTGGVSCPVWYFLPAAGVSQRVGAETTGVEATSGEEAT
SLEHGEKEDSAHCLKKTMNLLGRLDYRVVYDS
Download sequence
Identical sequences K3YDX4
Si012433m|PACid:19695514

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]