SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si012506m|PACid:19697518 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Si012506m|PACid:19697518
Domain Number - Region: 23-104
Classification Level Classification E-value
Superfamily Cgl1923-like 0.0235
Family Cgl1923-like 0.017
Further Details:      
 
Domain Number - Region: 5-52
Classification Level Classification E-value
Superfamily F-box domain 0.0255
Family F-box domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si012506m|PACid:19697518
Sequence length 213
Sequence
MAANKQQTSLETLPTELLTVIAIHLVATSDQPMEDLGSLRATCTVIRRVYYSLLRLLLDV
GNSEASLLTGIPDFFGGYQPSLDQLSRAAVAGLNVVADLYTLMLYRNVGGAAADDMAKMY
IRRLEGEEGTATSSSPKMLHNHVCRECREDAMYLVVRILWNNVALLLAPGRGEFPCDGGG
CGFPNGYGEDTLFCNEDCRLRHELVAFKRRLVD
Download sequence
Identical sequences K3YE46
Si012506m|PACid:19697518

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]