SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si012555m|PACid:19696932 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si012555m|PACid:19696932
Domain Number 1 Region: 120-342
Classification Level Classification E-value
Superfamily RNI-like 0.000000051
Family 28-residue LRR 0.058
Further Details:      
 
Weak hits

Sequence:  Si012555m|PACid:19696932
Domain Number - Region: 28-95
Classification Level Classification E-value
Superfamily F-box domain 0.0124
Family F-box domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si012555m|PACid:19696932
Sequence length 346
Sequence
METAPKRACASGSSAPGRVERFRLRLRYGLLHLVLSFLPSRQAMQSVVLSKRGIDLWRSM
PAVDLDISEFLSITRRSSQYCCKDVWGKMENFSTNLLMRHRAPRLDAFRLRIGSIMIDWS
RNSFFFSIATEYCPMELEIRLNRLDWSVLYQLPKLVSCHLKRFVLSGVSLEHSFAEHLHS
GCPALEDLVLWGCDTEFCGLQSETLKNLVIRSCTSRVADILVIRAPSPASLRLDLLYNTH
KNGVLLDTEKFLVKASISLASDQLSQRGEAILLGSLFSVTSLELGGFNAMAILDKEFDKS
PAFDNLRTLALNWCFHSKRDVNKFKALGRLLQKSPNLEKLTLQTFW
Download sequence
Identical sequences K3YE93
Si012555m|PACid:19696932

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]