SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si012583m|PACid:19696432 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si012583m|PACid:19696432
Domain Number 1 Region: 66-108
Classification Level Classification E-value
Superfamily F-box domain 0.00000000235
Family F-box domain 0.0069
Further Details:      
 
Domain Number 2 Region: 192-394
Classification Level Classification E-value
Superfamily RNI-like 0.000011
Family Rna1p (RanGAP1), N-terminal domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si012583m|PACid:19696432
Sequence length 518
Sequence
MANQNQEFVHIDDRTAADMRRKGFDPHEMEQSTQMILYYLYTSLPAPPVSAASRLSALRA
PSDVVDRISQLPFALLRDIVSRLPVKDAMRTAAISRRWRPVWRCSPLVFADAHLIPGAIE
GRRQPVRADTPGLVPAVTRVLAAHPGPFRSVHLVCGYMDAHQRQLARWIQTLIDKGVSEL
VLVNRPWPLEVPLPAALFGISTLTRLYLGIWKFPDTSGLRRGAGAEATFPHLRDLVLSAV
LIENRDLDFVLAGSPALETLGIQGNKNGVRLRLVGQHIRCVQICMCYVESIAVVDTPNLE
RLLVWGSMTRGGSCIRVKIGNAPKLSLLGYLEPGIHMLEIRNTVITAGVRASPSTMAPSV
KILGLHVRFGVRNDVKMLPIFLKCFPNVETLHIMSAKTDEVTGKLNLKFWQEVGHIESIR
SCIKAMTFREFQGVRSEVAFLKFVFQSAQALKKAVIVSAKGSFTSIGEAISKVRSLTPDN
WASNCSVFVYEGSGPEGGGLWNFRKGCDFSVSDPFAYH
Download sequence
Identical sequences K3YEC0
Si012583m|PACid:19696432 XP_004977827.3.39314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]