SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si012676m|PACid:19696193 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si012676m|PACid:19696193
Domain Number 1 Region: 1-36
Classification Level Classification E-value
Superfamily F-box domain 0.00000113
Family F-box domain 0.0057
Further Details:      
 
Weak hits

Sequence:  Si012676m|PACid:19696193
Domain Number - Region: 179-297
Classification Level Classification E-value
Superfamily RNI-like 0.000596
Family 28-residue LRR 0.098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si012676m|PACid:19696193
Sequence length 464
Sequence
LPNDILLSILERLQLREAVRTSILSTRWMHLFSIRSRIVVDVAAFHCKDDKGSMFTPATK
SMSARSSQYPISLLRIRFHLVEESIDIIHCVDGTLANRKISAVHFLILPEQRDRRCTEDE
LATNGRHFMRFVYAGSHASASLSYLHIRCFLMLIICYIHARSWSTSSFRVANVGLNLYVL
RIEHPHLTTLALDGCVFGKIELSWLPRLKCFSYRTWYLSQDQYPLSLGYVPQLSTLKLRN
EASIMHKTIRLSELLGNATISSLDLNFDSERIWIESEAPKVLGPLFQNLQILSLQCIHEE
CDLDWTMFFLEAAPLLNQIFIKVWDHTPSVPNCRPFQLLGDTCNIREEEYGEWQDVYQKG
YNLPMWEAPADLKHCNLKELIIKGYQVEEKFRYIRRLVKAAVNLEVIVLIHSGSCEYCKF
SPSTRYPWTQEERLQIKEQILEWRSSPIKLLGFESLECRPSHVK
Download sequence
Identical sequences K3YEL1
Si012676m|PACid:19696193

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]