SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si012677m|PACid:19697670 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si012677m|PACid:19697670
Domain Number 1 Region: 81-127
Classification Level Classification E-value
Superfamily F-box domain 0.000000000837
Family F-box domain 0.0073
Further Details:      
 
Weak hits

Sequence:  Si012677m|PACid:19697670
Domain Number - Region: 199-305,389-411
Classification Level Classification E-value
Superfamily RNI-like 0.000706
Family 28-residue LRR 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si012677m|PACid:19697670
Sequence length 540
Sequence
MAGQAAGTRTSRRSSAGRCPPSTAASSSTPTAAASTSSAADPHLDALISSALSTIHRALP
SPSVSVGGRLCALPDAPDGGGPDRLSCLPDALLRDIISRLPVKDAVRTAALSHRWRPVWL
SAPLVLYDAHLLPAPTDDIPSRVKRADSDAAAAAVSVILAAHGGPLRCAYLACGNMDGDR
ARVARWLQLLAVKGVEELLLINRPPLQIDKHLPATLFSMAALTRLYLCFLRFPATAGLPR
GAAFPRLRELGLCSVAMEGHADMDFILARSPELENLCFEGHMFPPLGLRLAGRSLRCVQI
HYSKVKSIAVVDAPRLARLIVMNSPLKAGGSCTIKIGNAPSLHLFGYFDPVSHVLQVGST
DIKAGTLVDARAMVPAVKILALKFHFRVRNDAKMLPSFLRCFPNVERLYIHSEKVNEPTG
KLNFKFWQEAGGIQCVESRVKQLVFHDFRGENSELAFLKFLVESARVLEKLVIVCADGCF
GSVDEANSKVKKNLFAGKKGAGGCALLVLEGAKEKEGAPWPYDRGFDFSRVDPFEFVVPT
Download sequence
Identical sequences K3YEL2
Si012677m|PACid:19697670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]