SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si012712m|PACid:19694667 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si012712m|PACid:19694667
Domain Number 1 Region: 177-437
Classification Level Classification E-value
Superfamily RNI-like 0.0000000000173
Family Cyclin A/CDK2-associated p19, Skp2 0.067
Further Details:      
 
Domain Number 2 Region: 30-109
Classification Level Classification E-value
Superfamily F-box domain 0.00000000667
Family F-box domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si012712m|PACid:19694667
Sequence length 477
Sequence
MTNHPTSQQTTADHHHRANPTSINTRPSTRFCHLPPDILYRIASKLPPKEFARTSVLSTE
WRGCTSSACPRLTFDVVAMCKCKREDLTYKHVWQFFLDVHNILWKHIGKVVETLHVKINF
EDSIFMAHPIDTWVDFAASTSRTKNLILDLKPKRFLEYMDTELYVFPFQLLDRESISRLQ
HMQLSFVSLDPPSHFKGFPNLRKLHLQMVHVSRKDLENMLSHCYTLEWLHIDRCRLDDEL
IVDSPLPRLTYLRVEFCLTKIRFNAVNLATFEYVGCLIPIDLVRSFKLQSANITFLNAIF
QHVLISLLNGLPSVQSLTLDIRFQRIEKQWLWDNPLKFTNLKHLQLLLYTLRRDLDRVLY
SLAFLRATPFIEKLEVHFNGCDLWLSEAGPCRKDLGQCRYVHLKHIWITGFKAARGQLEF
LLHVIENAPTLEVLLLQIGQYPPFPLGVDGPRIEKVKEIARTCVHPILPQNVTFDIK
Download sequence
Identical sequences K3YEP6
Si012712m|PACid:19694667

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]