SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si012736m|PACid:19693953 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Si012736m|PACid:19693953
Domain Number - Region: 195-353
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0118
Family Quinoprotein alcohol dehydrogenase-like 0.036
Further Details:      
 
Domain Number - Region: 5-45
Classification Level Classification E-value
Superfamily F-box domain 0.0163
Family F-box domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si012736m|PACid:19693953
Sequence length 374
Sequence
MADQEQPDWLDLPSDLLRLIGQRSREAVTGLAAFRSVCRTWRAAVGPAPRLLLPRAGSDS
GSSKHVLVFPLLRGWSIVVDARDASCHLSHLATGATASLPKLNAVWDGGRIRNLIYVHRP
DAETAIRTSAILCFTYLSFTDLLRFAVHNATPDAPAAEGMTIMMYHMMHAYGATGVLFCR
PGDAAWTKVAKPARLGGGFFDFAYHDGRMFGMDINGEMAVYDAATLDVLHRVQRPPATRN
FVTKMYHDAARLEEFDYVHLVSLPSKLVLIRTSVKSSQPVAFNIFELGSTPDGLAWLKVM
DAGNYELFLDGYHTTFWENSANSGTRIYYVHDEHYSIVSSAYCYSMQDNKLEQCIYRPPE
NSPECSTKPSWFVP
Download sequence
Identical sequences K3YER9
Si012736m|PACid:19693953

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]