SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si012744m|PACid:19695185 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si012744m|PACid:19695185
Domain Number 1 Region: 43-103
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000824
Family F-box domain 0.0051
Further Details:      
 
Domain Number 2 Region: 211-252,320-388
Classification Level Classification E-value
Superfamily RNI-like 0.000000581
Family 28-residue LRR 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si012744m|PACid:19695185
Sequence length 469
Sequence
MDTELDRGSDASTPDRSPPIAMEEETPAACHDGERGRGGAAAEDRLSALPDDVLRIVLSC
LTSLQAARTSALSRRWRHLWRAVPCVDIDQREFFRPPPPRPAATWIHAFRGVATEEEDRP
RAPAADLWDRFEDAADWLSLRHIGPSSPPPLDAFRLRVACGGFHAARKWIRRGLARRPAA
LHVRVDNDGVDAEDSGWPFFPDAHAAGAFTCRLRTLRLSGLTLTSDFAGALAADFPVLGD
MQLEDCRYEFTRLASASLKKLSIEYHDHAYNVDELVLATPSVVSLRVLGNAPPVALEHET
PSIVEATLTHRAGDLGVLRSLRGAASLKLFRFSTAALLDDGEPGGFPVFGNLGTLLLDGC
DVGAECHVLRRFLRNAPRLETLTLRNCLRNRVFSGGAPVSRSRKRKERAKRKRSDDQRAP
AGYPCRNLKLVELEFYEDNALKWFIRSKVLLRTRSVRSKSRTCEELQMV
Download sequence
Identical sequences K3YES7
Si012744m|PACid:19695185

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]