SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si012784m|PACid:19695921 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si012784m|PACid:19695921
Domain Number 1 Region: 139-402
Classification Level Classification E-value
Superfamily L domain-like 0.0000000000194
Family Leucine rich effector protein YopM 0.087
Further Details:      
 
Domain Number 2 Region: 31-79
Classification Level Classification E-value
Superfamily F-box domain 0.000000196
Family F-box domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si012784m|PACid:19695921
Sequence length 496
Sequence
GSITSGARKRNSHSQEGEHSQCCKRPRYSGPNLPEDILCHIHSLMPLRDAARAACVSRIF
LDSWRCYPKLTFSNKTLGLKRSNRRRADIARDFTSTVDHILKNHSGIGLKGLRLEAHDYC
KVKSYINSWLQIAITRGIEEVSLLVPSHYNFPCSVLSDGRGNSIRDLYLTHCAFRPTVGI
DCLRSLTKLHLYYVCITGDELGCLLSSSFALERLELRYCNELIILKIPFCLERLSFLMVY
ECEMLQMIESKAPNLSTFRFWVGPVQLSFGDSSQLKHLDVNFSSKNNSCSYVITKLPSIV
PHLETLTISSSIEMVNTPVVANKFFHLKYLEINLCGAFKAFSPYDYFSLVSFLDVSPVLE
TFILSVQQFVMKHDSVFEYASYMRQMPAHKHHRLKNVQIIGFCSAKSMVELTCHILENAP
SLECLTVDTVYDEEDDDNTGRCSVRKNGRCGPLTRDMILEADKALEAIRRNILGKVPSTV
KLNVREPCSRCHYIEL
Download sequence
Identical sequences K3YEW7
Si012784m|PACid:19695921

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]