SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si013372m|PACid:19691252 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si013372m|PACid:19691252
Domain Number 1 Region: 165-251,286-371,540-607
Classification Level Classification E-value
Superfamily L domain-like 0.0000000000102
Family Ngr ectodomain-like 0.056
Further Details:      
 
Domain Number 2 Region: 18-62
Classification Level Classification E-value
Superfamily F-box domain 0.00000196
Family F-box domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si013372m|PACid:19691252
Sequence length 669
Sequence
MPPKDAAAQGAPGGGGRGVDRLSGLRDETLFRVMAHLKAWEAVRTCVLSTRWRKLWASAG
HLDIRQPCLCAGRGVLPAARLERREVKFSVFVKTLLLRRRPLVPLESLRLCWSHETVHGG
ANIWVAHAVRRGAVEIELSGKHHNKYPSPECMNFIARDSDTVTIRLKILKLIHIRLDGTT
LTQLCSRCTCLEELELKDCQILEAPEIRSTMLKCLTMIRCQIRKGLSVHAPNLVALQFSR
NFWHVPWIQNLGLLAASNIYLQAPHKYNIYLQAPHKYTECSDLSSCNLKILKLSCVKLDD
TTLEQLYSRCTSLEELELIDCSVVGKKIQSTSLRCLTMIDCKFAIGSWVNVPNLLSLRCT
RPFQQVPCFWNMKFLVTAIIALDDSCIPSDSWWTWADDHKDESDHDGDFFAHSRAEDSDD
NDESGIDGAHSGAEESDDNIDVGIEKSGDDNDDESYLNDNTFAHAGAEDSDENHGSGPGD
EVDGCTVRYDEIAEEYNGDCGGMFGGYGMLCSLSNVRKMALSAHSGEVLLMRESKLCPDF
KNLKTLSLGEWCITPDFDILARVLQSSPNLENLFVHLDMANKSRVDFDKRASLFVSTNLK
KVEITCCKHNKMVDILAELFRVNIVTNKKVFVHHTACTCDVNRGTGSQAKRKAQTEAKKR
PVKQIRPGN
Download sequence
Identical sequences K3YGK4
Si013372m|PACid:19691252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]