SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si013425m|PACid:19690735 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si013425m|PACid:19690735
Domain Number 1 Region: 175-551
Classification Level Classification E-value
Superfamily RNI-like 1.59e-27
Family Cyclin A/CDK2-associated p19, Skp2 0.038
Further Details:      
 
Domain Number 2 Region: 26-67
Classification Level Classification E-value
Superfamily F-box domain 0.0000144
Family F-box domain 0.0081
Further Details:      
 
Weak hits

Sequence:  Si013425m|PACid:19690735
Domain Number - Region: 70-151
Classification Level Classification E-value
Superfamily RNI-like 0.000255
Family 28-residue LRR 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si013425m|PACid:19690735
Sequence length 620
Sequence
MEKKPRAAAGGGDDGGGSRGEASGSSEGGGLVERLPEALLVEVLGRLEVDDACSAAASCR
ALRGAASAAISAITTIDLSAFAPSNAILSRILAGNGAVRSLTVNCSLLDDSAASVIAKGS
LRELSLLKCSFTMSFFMAIGERCGNLRSLKLEMAVAPEVLYPRYSGFGTCLARIYAGCGC
LETLWVKFPLLDPCTADYENGMHFIPSTVKELLLQPVSHLRAKTVFTKTTSLKKHITDSL
GSLSLVLDTITDELVILITSNVRNLVELCLEDGPVTQPNLPEDLTNIGLQALGLCHNLRH
LSLTRRYCDFRRVNDFGILMLADGCKQLRTIRFGGFSKVSDAGYAALLHSGKDLKKFEVS
NGSCLSDLACLDLDKAAPNITEVRLLNCALLTSDTAISLAPCTNLKVLDLSGCKSIADSG
LVSISQLSRLTLLDLAGADITDAGLSALGNGRCLISSLCLRGCRRIGSNGIASLLCGTGT
INKTLVSLDIGNVPRISCRAVTVIVKNCEQLSSLCLRNCLLITDSSLEVLGSMGRDSKCS
LRMLDLAYCSKLSRNFLRLFEPPLFRGLRWLGVGKNVVQRRGCSPTVAELLEQKPGLTIC
GNACDMGCRNKCHPDIRFIQ
Download sequence
Identical sequences K3YGQ7
XP_004973816.1.39314 Si013425m|PACid:19690735

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]