SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si013468m|PACid:19693006 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si013468m|PACid:19693006
Domain Number 1 Region: 81-142
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000968
Family F-box domain 0.0086
Further Details:      
 
Domain Number 2 Region: 198-286,414-495
Classification Level Classification E-value
Superfamily L domain-like 0.00000000255
Family Internalin LRR domain 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si013468m|PACid:19693006
Sequence length 587
Sequence
MPPKVTKRWVPVNRVEGAPCGGGGGDPATARRRVLPDAPLHHRLVPPKNTTPPKGTMRWV
PVNRAGGTAASRGREGGVPDADRLSALPDALLHHIMSFLKAWEVVRTCVLSWRWRHLWAS
APCIDLRIRGDDNGNTPEDFPDFVRHLFRRREVSAKLDTVHLRSSDDAGAHDVRLWIRTA
IKQGARVIHLVGHRKEHWLRGSSLAVLEHASFVSCHLKILKLSYALIDENILRQLSSHCL
SLEELNLKDCLITGHEISSASLKVLTMFKCQINVNLSISAPNLVVLRCISPITQAPSFEN
MGFLVTGTIILDDYAFGDDFEDISKYERDATTDEDDDCSDSNWKNKTRYGFGAPLEGYGL
GYKDDYGYGSDIESDGNTFEYSEIAIDCDEYGINGDGHNSTMDGNRQISGENSGCNDNKI
KGGHNVLQSLSNATSLELLADAGEVILTRELKRCPSFSNLKTLSLGEWSMDAGFDALVFL
LQHSPNLERLFLELKLNFNNKKPLVSSVKPKEKSFACKHLQLVKIKCSKDDARVHKLAHL
FRTNGISVDKIFVRRTGSAYLRGKKLMKDLARLELEFWGEVMPTCPV
Download sequence
Identical sequences K3YGV0
Si013468m|PACid:19693006

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]