SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si013522m|PACid:19691253 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si013522m|PACid:19691253
Domain Number 1 Region: 94-254,283-347
Classification Level Classification E-value
Superfamily RNI-like 0.0000000000188
Family 28-residue LRR 0.09
Further Details:      
 
Domain Number 2 Region: 18-62
Classification Level Classification E-value
Superfamily F-box domain 0.0000015
Family F-box domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si013522m|PACid:19691253
Sequence length 543
Sequence
MPPKDAAAQGAPGGGGRGVDRLSGLRDETLFRVMAHLKAWEAVRTCVLSTRWRKLWASAG
HLDIRQPCLCAGRGVLPAARLERREVKFSVFVKTLLLRRRPLVPLESLRLCWSHETVHGG
ANIWVAHAVRRGAVEIELSGKHHNKYPSPECMNFIARDSDTVTIRLKILKLIHIRLDGTT
LTQLCSRCTCLEELELKDCQILEAPEIRSTMLKCLTMIRCQIRKGLSVHAPNLVALQFSR
NFWHVPWIQNLGLLAASNIYLQAPHKYNIYLQAPHKYTECSDLSSCNLKILKLSCVKLDD
TTLEQLYSRCTSLEELELIDCSVVGKKIQSTSLRCLTMIDCKFAIGSWVNVPNLLSLRCT
RPFQQVPCFWNMKFLVTAIIALDDSCIPSDSWWTWADDHKDESDHDGDFFAHSRAEDSDD
NDESGIDGAHSGAEESDDNIDVGIEKSGDDNDDESYLNDNTFAHAGAEDSDENHGSGPGD
EVDGCTVRYDEIAEEYNGDCGGMFGGYGMLCSLSNVRKMALSAHSGEVQLNHLFLYALQH
SVK
Download sequence
Identical sequences K3YH04
Si013522m|PACid:19691253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]