SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si013533m|PACid:19691151 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si013533m|PACid:19691151
Domain Number 1 Region: 196-454
Classification Level Classification E-value
Superfamily RNI-like 0.0000000000259
Family Cyclin A/CDK2-associated p19, Skp2 0.057
Further Details:      
 
Domain Number 2 Region: 60-119
Classification Level Classification E-value
Superfamily F-box domain 0.0000899
Family F-box domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si013533m|PACid:19691151
Sequence length 538
Sequence
MISGGRKVSSSTGTMETPALQSEQERPRQTTASNGSTAPVVDGIQGTTPSPSRRVDGGDS
KDGETSGCSIPDLPMDIWRHIHSLMPMDAAARAACLSHAFLSSWRCYPKLTLNMHALCYK
PRAFGNYFFPTYDGGNLTCRIDSILRNHSGIGLKILRLDLYGQFRSFPYIDSWLQVAVTP
GIEELTLRLHEKYKLPCSILSDGVRNSIRSLQLDCCVFRPTPEPGPLRNLTKLSLMRVRI
TGDELECLLSNSLALEHLDLTGCDEIIILKVPSVLQQLCQVTVIVCRNLRVIENKAPSIS
SFTLTGEVSTLSLGEASQKMKVLGLDHANAVHYARAKLPAIMPNLERLYLCCNEVDTPML
PTKFLNLKHLYIQTIAPTFSPYLDYFSLASFLDACPSLESWNLEVSHQEVMEHESIFGGS
SHLRQLPECRHHHLKSVGIIGFSSAKSLVELTCYIVKSAVSLERLTLDTLPFVSRCSGAN
KHEDCTSISISKSLFEEVPRGVAAIRKYIEDKVPPTAELTVLELCPRCHTTIVDEDRG
Download sequence
Identical sequences K3YH15
Si013533m|PACid:19691151 XP_004972460.1.39314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]