SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si013595m|PACid:19690835 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si013595m|PACid:19690835
Domain Number 1 Region: 162-303
Classification Level Classification E-value
Superfamily RNI-like 0.000000000051
Family Cyclin A/CDK2-associated p19, Skp2 0.033
Further Details:      
 
Domain Number 2 Region: 10-64
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000693
Family F-box domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si013595m|PACid:19690835
Sequence length 504
Sequence
MERHRVATDDSLNPSSSHIDDLPEEIQTLILSLLSLKEAARTSIVSRKWRPLWTRHPNLS
FDGTRNRSNDEDCVKIERAEFIETVNSIVQQHSGVGLNRFCIRCGIEEESSDHLDRWICF
ATAARAKTIDINLLPKGCIRRPTKGDYHFPLEALGARDGPFIQSLLLTHVSIEPYSDVCG
FTKLRRLLLHSVQITGDLAGLLLNCSSLEDLELIACSGLTDLIIPHQLDKLRHLLLSDMC
VQMVDFHVPGLAHFNYKGDVVPIALHGCSKLEKAIIMFKNYKVLGHAFTAIHGISAVKVL
NMRAAMQEDHPVWGSQVQMVTRPTCMFMSLRHLTCEIKIHTYRPNSHSGLLQLASYLEFA
PQLEILQVHMFYYKFSSSCWKGEVTGKGISFMHGLDHLKSVYMSGFRGFRAQVEFLCGIL
AKGDALEHVTIEPQVKLRCARMVNVFILEWEINEWARRLSERFGKAITVAPPVREPLGLF
ASAYKPAEKLKRLICCERKIPFDG
Download sequence
Identical sequences K3YH77
Si013595m|PACid:19690835

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]