SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si013597m|PACid:19692240 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si013597m|PACid:19692240
Domain Number 1 Region: 56-99
Classification Level Classification E-value
Superfamily F-box domain 0.000000693
Family F-box domain 0.0092
Further Details:      
 
Domain Number 2 Region: 159-279,331-376
Classification Level Classification E-value
Superfamily RNI-like 0.00000192
Family 28-residue LRR 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si013597m|PACid:19692240
Sequence length 504
Sequence
MASCAPFPNLDRTSAADLRDTEHLLSYICSCVPDPPVSTTARLVARRGAAASKDGVDRIS
GLSDALLRDIVSRLPFKDAARTSVLATRWRRVWLAAPLAVADAHLLDHWPPAPADAPAVT
AAVSGALAAHPGPFRCAHLVSTRMDAYQPQLKRWLRILAAKGVQELVLVNRPGPREVPLP
DTLFRIANLTCLYIGFWKFPHASHLQGASFPNLRELGICSVVVKDGDIDSLVARSPLLEI
LNIQGSMKGLCLVGQSLRCVQICASMVESITLVSTPCLERLILWEVRASPNPASGLRTRI
KIGTAPKLCVLGYLDPTQHLLEIGGTSIMPGIAPSASTILTSVKCLSLKVCFGANDAMKV
PAFLKCFPNVEALHIMSAKCDEPADKLNLKFWQEVGPIRSVVLCVKVMTICEFRGGQHEL
AFLQFIYQNARVLNFSAIVSANVRVTGISANQIFSIVQNMDSSRWARNFNLAILGSKGPE
GGRPWKFQRGANFSNDDPFAPVKS
Download sequence
Identical sequences K3YH79
Si013597m|PACid:19692240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]