SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si013610m|PACid:19691271 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si013610m|PACid:19691271
Domain Number 1 Region: 143-426
Classification Level Classification E-value
Superfamily L domain-like 0.0000000000000544
Family Polygalacturonase inhibiting protein PGIP 0.07
Further Details:      
 
Domain Number 2 Region: 23-65
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000929
Family F-box domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si013610m|PACid:19691271
Sequence length 498
Sequence
MERRSGVRDALAPPPTPSISFRMEALPEEIQLLVLSLLSLKDAARASTVSRNWRKLWTWH
PNLCFDGTKSGSADEDSVKIEKAKFIETVNAIIQQHSGIGLNKFSIRCSLQNNSSDHLDR
WICFASAAKAKIIDLNLQPKRNDACRTENVYHFPLEALSAQGFPFIQSLFLTNVSIEALS
DICSFTKLRRLHLHHVQIIGDLPGLLLNCSILEDLELIACSGVADLNITHQLAKLRHLLI
SNMCVHKVDFHVAGLTHFGYKGDVIPIVLHGCTKLEKVTLTFQMPLHEQVSNKGLGHAIT
GIPSISAVKELNIRAYMQEDQPIWSSQVPRMTRPTFMFVNLRHLTCEITIFTNSPNTHTG
ILQLAHCLDCAPQLETLKLHVSTLLFSFCFSFFMQYHVMGSRCWPGEGILPMRRLDHLKT
VYMSGFRCYRPQVELLHGILENGAALEHVTIEPTVTLYVDSIANIGVPEDKICEWAHRAS
ERFGKAITVVKAHRRRWS
Download sequence
Identical sequences K3YH92
Si013610m|PACid:19691271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]