SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si013617m|PACid:19691088 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si013617m|PACid:19691088
Domain Number 1 Region: 7-70
Classification Level Classification E-value
Superfamily F-box domain 0.000000305
Family F-box domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si013617m|PACid:19691088
Sequence length 497
Sequence
MSSGDLDGAALILSLPEDVLALISARLCTRDLLALSAASRRLRHALYGGGADKAWLAQCR
RLLPSPPHLLAWRAAAGGSSLAVCRFLHSAAPLLGALWAHQNPELGNLVAAVPGFLSVVA
ARAIPQELSPRLRWAPVFELLADAHGRPAILFLHGHQPADLFPARLSSLQPHANVLFLEA
QTDQDPIAASSSHQFPRLAFGDRRRLLDSLVDACRVTLPPDLVAAPLFARSEEDLPVLAA
RREAMLRLHREAGGGMVRTPEVQGLLLEAKKKAAPSSPSDGGERIRLRRSLSAVAVAVRN
GLRQMLTVQPPVPGREYSGLWGGTFGWPPGRPEDECKPRKALFFLLLSYEEDSEGKPLLI
ATKVLEGTHYVVHPNGSSMFVARMGEPSTEAFPWQTDGESRNVDVERGFAGEGIATGYGF
RYPGSKPGSLFVLQDGQLAFVWKETGAVLTLKRLNLEELLKKGERVPALQPVPNFAYLTK
SYSNVFTGFPGSSASPR
Download sequence
Identical sequences K3YH99
Si013617m|PACid:19691088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]