SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si013731m|PACid:19693041 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si013731m|PACid:19693041
Domain Number 1 Region: 107-294,340-449
Classification Level Classification E-value
Superfamily Tubby C-terminal domain-like 1.23e-99
Family Transcriptional factor tubby, C-terminal domain 0.00000757
Further Details:      
 
Domain Number 2 Region: 54-102
Classification Level Classification E-value
Superfamily F-box domain 0.00000968
Family F-box domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si013731m|PACid:19693041
Sequence length 449
Sequence
MSFRSIVRDVKESFGSLSRRSFEVRISGLPGLGHHRGKSVGSLSNLHDRPIVVDQSRWVG
LPPELLRDVMKRLEEGESTWPSRKDVVACAAVCGTWREICKDIVPSPEFCGKLTFPVSLK
QPGPRDEMIQCFVKRDKSTSTYYLYLCLSPAVLSENGKFLLAAKRNRRTTYTEYIISMDP
KNISRSSNGYVGKMRSNFLGTKFVVYDTQPPYNAGSLVSCGRSSRRISSRRVSPKVPTAS
YPIAQVNYELNVLGTRGPRRMNCTMHSIPASAMEPEGMVPCQPKQLFLPASSSYEESFRS
ANTSSSSRFSVTDRSLDFSSSRFSEVSGVIQQNEDDGQAKERPLVLRNKEPRWHEQLQCW
CLNFRGRVTVASVKNFQLIAAPQLDAVPSESSQQAQPSSSSSASDHDKVILQFGKVAKDM
FTMDYRYPLSAFQAFTICLTSFDTKLACE
Download sequence
Identical sequences K3YHL3
XP_004972405.1.39314 Si013731m|PACid:19693041

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]