SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si013814m|PACid:19690873 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si013814m|PACid:19690873
Domain Number 1 Region: 80-293
Classification Level Classification E-value
Superfamily RNI-like 0.0000000000361
Family Cyclin A/CDK2-associated p19, Skp2 0.043
Further Details:      
 
Domain Number 2 Region: 2-36
Classification Level Classification E-value
Superfamily F-box domain 0.00000222
Family F-box domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si013814m|PACid:19690873
Sequence length 421
Sequence
MDALPDGVVQHILSQLSNARDVAACAAVARCWRGCVPYLPSLYFPRGAFEAASGGSASSS
AVAAADDAIGRMVAAAARLEELVVYCPFSASLLPRWLAARAATLRVLELRVDSAAADKSG
HLDCIGVAAGLEELRLWGLTMTRPPAWGRMERLRVLEIIGTELGEAVVNGAVAACPNLTD
LALLGCECAGEAVISLPLLERCRLDFVGGGNCSLRLAAPRVESLEVQGFSWISMQGGDRL
KHLTISKNTGTVYHVEMGKLPELDHLSLRGVQWSWGAISSVLQCASEVKHLVMKVEFCGD
IDQLQPFPEIDLVQFFNSHTKLCKFEIHGAMFAALCQKNSLKNLDSRFVIPCLEQVLVTV
RSPLNAEQKLSTLESLVRYSVRLRRMIIRISQMKNCHEAADDFFAEICKFTYMNSESVCI
E
Download sequence
Identical sequences K3YHU5
Si013814m|PACid:19690873

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]