SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si013898m|PACid:19692098 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si013898m|PACid:19692098
Domain Number 1 Region: 2-59
Classification Level Classification E-value
Superfamily F-box domain 0.00000828
Family F-box domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si013898m|PACid:19692098
Sequence length 391
Sequence
MDFVDRLGPDASAAVFAVLRDPADLAHAAAVSRSWRTLVMVVHMSKIQCLRLCPEVASFT
RIELEQPTNSASGSDSGVNEEDAGSTAATTTWENYKTEKMVYMHLVHALFSPHTWMSCIT
ACLGASSTDNFPGESIQNTLEPRERVNNWPCYWSSGGQEDPAVPEFLVYKLCSDLCLIDE
IRIQPFRAYFQRGLPIYSSQYVRFKFGCPKLPLRLEDLVSEENEGQLTADDNYIWMYTSS
EFPMLQKNVLQSFKLPRPVLCIGGVVKVEFLGRIQKQREDDQYYICVSHVQVLGTPLPRE
FGAAPCQNGPVLKYYPDHEPSDDSGGRINWKGFEESMWRALVINGQGIGLNQELLSRLLG
PSLQLAVEEERMAKAKRRRSLTHYLRRFSGM
Download sequence
Identical sequences K3YI29
Si013898m|PACid:19692098 XP_004972534.1.39314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]