SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si014026m|PACid:19691382 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si014026m|PACid:19691382
Domain Number 1 Region: 6-58
Classification Level Classification E-value
Superfamily F-box domain 0.00000000484
Family F-box domain 0.0062
Further Details:      
 
Weak hits

Sequence:  Si014026m|PACid:19691382
Domain Number - Region: 159-307
Classification Level Classification E-value
Superfamily DPP6 N-terminal domain-like 0.00177
Family DPP6 N-terminal domain-like 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si014026m|PACid:19691382
Sequence length 340
Sequence
MEPPPLRAPPDELVEEILLRSPPDDPASLVRAALVCKRWCRLVSAHPFRLRFRGLHRCPA
PMLGFLCNDVFHAGGDEACSARFVRTAASCPPLASRRGWHALDARAGRVLLHRAAAAQAI
CLAVWDPLAAGDSRHLDLPAPALPRRPRSWNAALLCDDDPDGGPFRIVLHPKDHVDAVRG
ALVGDTIYFVCQRRTRVLRYDLATRAMSVVHLPPASHNQRIVLTTAEGGGLGFARMDGYW
LGLWSMDVGGGGGAVEWTQDRVIDLRTLLPVIDLLGFAHGLGIVLVGTVDGFFSVDQKSG
SINKVGDGPGFYNVVPFVSFYTPALGTASTTDEEGSSSNA
Download sequence
Identical sequences K3YIF7
Si014026m|PACid:19691382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]