SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si014046m|PACid:19691445 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si014046m|PACid:19691445
Domain Number 1 Region: 49-103
Classification Level Classification E-value
Superfamily F-box domain 0.000000000948
Family F-box domain 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si014046m|PACid:19691445
Sequence length 334
Sequence
MPCRAGSTQHRTSRDGETPPVRFAVDLVVTRASEPRAMAAAAAAEGRQQQEQETRVCDLP
EECLALAIALTSPRDASRCAAVSPAFRAAADSDHVWQRFIPTDDGSFLLPGAEKKRKKKK
DAYLGLCDAASAVAVGDDDGGCWVWLDRATGARCYALSARRLSLPWDDGEFSWRFTPHPL
SRFGEVAELVECTCLDIYGRLPTAALTPATPYAAYLIYDTAPEGQHRGLSFLDQETSVSL
GGSMAAAARHAVCLRPDDAEARKFRGGGGGGEDGQVRRPRRREDGWWEMEMGRLPSTATG
GEPEPQEVVASFEALGWYPKRGLILHGIEFRPLH
Download sequence
Identical sequences K3YIH7
Si014046m|PACid:19691445

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]