SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si014460m|PACid:19691233 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si014460m|PACid:19691233
Domain Number 1 Region: 70-188
Classification Level Classification E-value
Superfamily RNI-like 0.0000000241
Family Cyclin A/CDK2-associated p19, Skp2 0.061
Further Details:      
 
Weak hits

Sequence:  Si014460m|PACid:19691233
Domain Number - Region: 16-48
Classification Level Classification E-value
Superfamily F-box domain 0.000106
Family F-box domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si014460m|PACid:19691233
Sequence length 210
Sequence
MAAAANRARAAGGSIHDRLSALPNDLLRCVLSLLPAQQAVQTTALSRRAFISIGPGEFPP
RSEARLIGSLCGVTNLELKGFQTMAMLDKEFDKVSIFGNMRTLCLDSCFYNPSNCDLHKF
KAVMRFLQKAPNLEKLTLKNFRVSQVVEPVEYPKLENLRTLFLNKCDLHDNFGILQYCLR
NSPNLEPLQALGWFHARGRKGQVKEDIFSS
Download sequence
Identical sequences K3YJP1
Si014460m|PACid:19691233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]