SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si014851m|PACid:19691232 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si014851m|PACid:19691232
Domain Number 1 Region: 4-77
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000942
Family F-box domain 0.0086
Further Details:      
 
Weak hits

Sequence:  Si014851m|PACid:19691232
Domain Number - Region: 112-228
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.0288
Family Galactose oxidase, central domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si014851m|PACid:19691232
Sequence length 366
Sequence
MPPPPELMEELIEEILLRFPPSDPASLVRAALVSTSWCRIVSGAAFRRRFRAFHRTAPLL
GFLCDSRVKMDGFRWDGVLVPTSSAFRPREPFAWWQPLDARHGRVLFHDCSSSSYRPHVW
NPITDACITLPEMPNDDRDDISLRWTSRWTSAVLCAAAATGECDHLDCHDGPFTVVISGR
WSEPTYADCRNYSISWDHSVLMGNALYFKFDTNNCGILRYDLGTREMTMMDLHLPRYEDY
DASSVPSIQLMTTEGGRRLGFIRLEDTRLCLWSRDDEADVGWAPNRVIELEKLLPFDVSL
AYDTFLLGFAEGVGVIFMRVGDGVFTVDLKSSKVMKVYEGSINSVVPYMSFRTPGTDLGT
MTIFFK
Download sequence
Identical sequences K3YKT2
Si014851m|PACid:19691232

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]