SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si014877m|PACid:19691267 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Si014877m|PACid:19691267
Domain Number - Region: 120-346
Classification Level Classification E-value
Superfamily L domain-like 0.0034
Family Internalin LRR domain 0.082
Further Details:      
 
Domain Number - Region: 1-35
Classification Level Classification E-value
Superfamily F-box domain 0.0105
Family F-box domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si014877m|PACid:19691267
Sequence length 407
Sequence
DILHHIHSLLPLRDAARAACSSRTFLRSWRCRPILTLNRHILGSNANAPQESFSCRIDNI
LRNHSGIGVKIFMLELYGIFYACHYLDRWLQIAVTPGIEKLTLQLCHRDKMKYNVPCTLL
SDGVRNSIQCLQLSLCAFHPTAELGPLRKLTKYFLSNSPALKQLDLSECQEIMCLKIPCV
LLQLHCLKVSYCSKLRVIETKARNLFSFILIGERVKVSLGETMQMKNLCMHRRNLVCYAR
TELPSNMPNLETLSIGSYYERVNTPMLPTKFLFLKCLSIFLKWTFCPSYDYFSLVSFLDG
SPSLDLRQIPEQHHDHLKSVKIIGFSSAKSLVELTRYILKNAKSLDCLTLDTTYGDPKCD
TEIAGFLMEARRGAAAIRTYIEDKVPSRVKLTVVEHCRRCHADTLSE
Download sequence
Identical sequences K3YKV7
Si014877m|PACid:19691267

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]