SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si014919m|PACid:19690900 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si014919m|PACid:19690900
Domain Number 1 Region: 122-232
Classification Level Classification E-value
Superfamily RNI-like 0.000000011
Family Cyclin A/CDK2-associated p19, Skp2 0.046
Further Details:      
 
Domain Number 2 Region: 17-70
Classification Level Classification E-value
Superfamily F-box domain 0.0000000235
Family F-box domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si014919m|PACid:19690900
Sequence length 468
Sequence
MHVMITRSKRRRREDDESHRQEEEEDAGRLDLISRLPDDVLGDVITLLPAAEGARTQVLS
RRWRPLWRSSPLNLEAKNLAAAQAILGSHNGGPGRRFSLTCPGYYYADGCPVIDDMLRPP
GLDGLQELCVSVKHALWDPAPSSILRFSPTLRVLSVSSHRTRLKFEAAACCTLDFPRLEQ
LTLKGVSISESILHGILSRCLVLQSLVMQYNHGYRRLRISSPTLRSLGVSDWVYRGKEGK
LQEVIIEDAPLLERLIQEGLQIRVVQAPKLKITGYLADGISKFGTWVFKKMELVTLPNAM
RTVKILALDVSPHNLEVVIDFLTWFPCVEKLHMVLGHRKKLTNVQAKSMNVPRHVSLECL
DEHLKMLEVKGYRGNVPQVRFIEFILSNARVLESLEFRTARGRCGPKWIASQRRKLLRRR
AIASRGARFSFEPESDHCPPSSVPIKHIHNLALGDPFDIGPTHDDLSL
Download sequence
Identical sequences K3YKZ8
Si014919m|PACid:19690900

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]