SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si014937m|PACid:19690765 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si014937m|PACid:19690765
Domain Number 1 Region: 180-266,294-355,523-594
Classification Level Classification E-value
Superfamily RNI-like 0.00000000000373
Family Cyclin A/CDK2-associated p19, Skp2 0.034
Further Details:      
 
Domain Number 2 Region: 15-68
Classification Level Classification E-value
Superfamily F-box domain 0.0000000183
Family F-box domain 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si014937m|PACid:19690765
Sequence length 602
Sequence
MPPKDAAAQGAPGGGDRLSGLRDEILLRVMGHLKAWEAVRTCALSTRWRNLWASASRLDI
RHPWPCCLLAADDQVPVVEAFAAADQVLAETFAVADQVLAETFAAFVKNLLLRRLPLAQL
DSLRLCWSHEAPDGNANFWIAYAVRHGAEEIELSAEHHFPKPSPQYMRFIVDGDEDANYR
LKILKLIHVRLGGTTLTQLCSRCALLRELELQDCDIPYETKIQPILLERLTMIRCQIMRP
LSVYAPNLVALQFSGNLGYVPWIQNLGLLAASNIKQQAEAPHYNYSEGSSLGSWDLKILK
LSHVHLDDTILRQICSRCTSLEELELKNCSIDGEEIGSTSLKYLTMISCKFSIAFRVQAP
NLALLRCIKPFQHFPLIQKMEFLVTATIVLDDYCLLPDCQWLQEEDDSDDNSNDDYDNYF
GDNKSNESDGSSNYYDSDRSASSDEEDDDRTVGYGEISKEHKHKPYKYLINGHKRRADEP
MENFHGKHGSDNFGGVGMLLGLSDVKTMDLLAHPGEVLLTRELKSCTDFKNLKTLSLGEW
CITPRFDVLAAMLGHSPNLEILFLHLDMAYNSRVGFNLWASSFECTNLKTVNITCLVDRK
FR
Download sequence
Identical sequences K3YL16
Si014937m|PACid:19690765

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]