SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si014965m|PACid:19692974 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Si014965m|PACid:19692974
Domain Number - Region: 9-80
Classification Level Classification E-value
Superfamily F-box domain 0.000206
Family F-box domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si014965m|PACid:19692974
Sequence length 111
Sequence
MKPSRVFMAANRQQPSLETLPMKLLTVIAIHLVATSDQPMEDLGRLQATCTVMRRVCGQC
AVVRHVALLRCWEEVQWNQPSRYYSLLRLLVDVGNPEASLLTGIPDFFGGY
Download sequence
Identical sequences K3YL44
Si014965m|PACid:19692974

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]