SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si015013m|PACid:19690838 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si015013m|PACid:19690838
Domain Number 1 Region: 20-91
Classification Level Classification E-value
Superfamily F-box domain 0.00000000968
Family F-box domain 0.012
Further Details:      
 
Weak hits

Sequence:  Si015013m|PACid:19690838
Domain Number - Region: 134-271
Classification Level Classification E-value
Superfamily Kelch motif 0.0314
Family Kelch motif 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si015013m|PACid:19690838
Sequence length 397
Sequence
MSLSPERSDSTDNDDGKNGGAANLPDDQVFELLTRVPLDDLAACRVASPRWRSITYEPAF
APLHCRRATAVSGYFVQSMQRNRYRADFVSMHTSPPKAAVSLDFLPSAHVRLEAVAAHRG
LACCVEADTRRRPCYYVCKPATRQWRALPNPRARFPTAATAMVARPSAAAAEFKIVRLSI
PALHDRLRCEVFDSRRFAWRRAADVPLCPESLYPSAPAVRAHGGMHWLRWPDRTGAQDVF
AFDLRSEVWRLIRLPREVEERDDPWARKHISAVEGRLCLMVTTMGVGEVDTLEVWEMAGY
AEGRWEKKMTVSLKSLHAQEGDGVILQHLHSADVGFFKTFYRVMWYDFLRGKKAAEVKVD
HVCVQEIFKFESDLIPCELGGKARAPSEEVQKGDYMF
Download sequence
Identical sequences K3YL91
Si015013m|PACid:19690838 XP_004974906.2.39314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]