SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si015120m|PACid:19691442 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si015120m|PACid:19691442
Domain Number 1 Region: 7-44
Classification Level Classification E-value
Superfamily F-box domain 0.000000000392
Family F-box domain 0.012
Further Details:      
 
Weak hits

Sequence:  Si015120m|PACid:19691442
Domain Number - Region: 108-266
Classification Level Classification E-value
Superfamily NHL repeat 0.0366
Family NHL repeat 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si015120m|PACid:19691442
Sequence length 394
Sequence
MDGEGCWDFPSDAFAEILLRLPATSRRRFRLVCRHWCDVIDDRAPARPSEPKPLTYVIRD
RGWSCATGSAYVIDDPAAEGRCREVWRGGPLPATGCCFDTRMVGTCNGLLCLCDNTRPGG
AVSLVNPATGESLALPPLPGHARIGGIITRWHETYGFVQHPATGRYTVVHLPCYSDRTGQ
LDAVRAFTLGEAVAASAWRDVAAPVGANCRLDAGLVAVDGAAYWVTKGSERVMSFDAEDE
RVAPVAALPVAVVDGNCCHLTEVRGRLGFVVTVDEPKLARVEVWVLEGGRDGRAWSCRYR
VQVHGAPKASRQQLARPHFVFARAGECVLTIGPEDRESVVFAHRLAGAGRLQCGEVRTNE
RKPGTPVARARNAHIRTFAYVETREPLSVYSRAR
Download sequence
Identical sequences K3YLJ6
Si015120m|PACid:19691442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]