SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si015131m|PACid:19691309 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si015131m|PACid:19691309
Domain Number 1 Region: 7-51
Classification Level Classification E-value
Superfamily F-box domain 0.0000000105
Family F-box domain 0.0057
Further Details:      
 
Weak hits

Sequence:  Si015131m|PACid:19691309
Domain Number - Region: 162-290
Classification Level Classification E-value
Superfamily RNI-like 0.0259
Family 28-residue LRR 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si015131m|PACid:19691309
Sequence length 464
Sequence
KTRDCSRTGDLDRISALPDDLLHVILGFLADAHAVTSTAVLSRRWRRVWVHAKNLAFTDR
LEKYAVPTHFAGFVDWALAQRDDSGIKSLKICVSRTGSGSGCTSLEQVNEWLRYAGRRVA
GFLELQLGAPTDRRHAVELPSHGRATSIQLTLLKHRLRLPAATAARYEALTELSLSSPVF
AGAGTLGDLPRRLRQLVLRSEALGELEVTLALDLRTLDMTAPSLRAVRLTLCFHNPMRGI
EDAAAGKVARIAAPRLEEISMHHCFRDAPPPELDIHDLASVRRLDKLWLEMHGKRCPGVE
HVDAWLHHYEEKPDAAIADDEFVDLTAQGAPPFANVRSMELSAWCLPARDLVPSVSSLLM
RAHEEMQLVTTLFERSKNSIRRMTLGGVTQIKPKTIHLKWNTAEEDGGDDDDDDDTDTID
EQLMKIPITDRGCWHFAKEVFTWMNVERRTKQREVGSIVSNKIS
Download sequence
Identical sequences K3YLK7
Si015131m|PACid:19691309

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]