SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si015164m|PACid:19693014 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si015164m|PACid:19693014
Domain Number 1 Region: 7-59
Classification Level Classification E-value
Superfamily F-box domain 0.000000000115
Family F-box domain 0.0039
Further Details:      
 
Domain Number 2 Region: 112-233
Classification Level Classification E-value
Superfamily RNI-like 0.000000000445
Family 28-residue LRR 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si015164m|PACid:19693014
Sequence length 248
Sequence
MLSATRDWSALPLDVLVSIFTNVGAVDVLTGTSLVCHSWLEAAKVPDLWRSVDMANHNVE
KVDEDDLRALAKVAVDRSKGQLEVFLGKLFVTDGLLMYIADRYSLISVLDLIFSLSLISC
HDVTNKGFSYLIAKSPLLENLSLELCPRIGGRGIYEATGKACPQLKRFRLHRELFRFSFN
YPRRYQEERGLEVMHELRSLSLIGTTVSNSGLEAILDSCPHLETLFLRDCYLVVPDSALR
AKCARLKT
Download sequence
Identical sequences K3YLP0
Si015164m|PACid:19693014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]