SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si015210m|PACid:19692640 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si015210m|PACid:19692640
Domain Number 1 Region: 118-272
Classification Level Classification E-value
Superfamily RNI-like 0.000000000000112
Family 28-residue LRR 0.081
Further Details:      
 
Domain Number 2 Region: 26-136
Classification Level Classification E-value
Superfamily F-box domain 0.000000000288
Family F-box domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si015210m|PACid:19692640
Sequence length 343
Sequence
MPSRGLGGRARRRRACRRRRDAAVARDWAGGLGTDALLAIFRRLDHVDVLLAADNVCRSW
RRAAREEPTLWRRITMRGHEGIARRLNRGGMACEAVRRAAGQCEAFCGEYAGDDGFLMYL
IEQAPCLKSLRLISCNYVSNEGFTEPVKKLPLLEDLEVSLCDNVGGYYACGSDRRSDVFE
VVGEVCPKLKHFRRSNKLFDVRVWWNKDDDVQGIATMHGLRSLQLFGHALTNEGLETILD
GCPHLECLDIRHCFNIDMDEALHLKCAGIKTLRLPDDPTDDYDLEVHSPIRMVVEEEIVW
DSGYYSDDSGDDDWDFYGEPSRYESDLDKYEKMLPLNMRTFLK
Download sequence
Identical sequences K3YLT5
Si015210m|PACid:19692640 XP_004974360.1.39314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]