SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si015290m|PACid:19691758 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si015290m|PACid:19691758
Domain Number 1 Region: 36-92
Classification Level Classification E-value
Superfamily F-box domain 0.0000000576
Family F-box domain 0.0045
Further Details:      
 
Domain Number 2 Region: 185-254
Classification Level Classification E-value
Superfamily RNI-like 0.0000235
Family Rna1p (RanGAP1), N-terminal domain 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si015290m|PACid:19691758
Sequence length 264
Sequence
MATSSSSSRHRRPRLAEQGQPPAAQVPRMEGKCEEDEEEESRDWAELPRDALLSVLRRLD
QADVLMGAEHVCRPWRRPAQEEPDQWRGVDLRGRVALASPAGALKAMAYAAARRGAGRCE
AFWVKGVRDDSFVFFLSCKAPALKSLRPHLRDTGAPHAQDLELSLYSGAATNHGLINLAE
TCAVAAEACPLLNRLRLSRYRFDWRSGGVGDGEAVGIAGMRGLRSLQIFGNSLSNAGLAA
ILGGCAGLESLDIYPPLLQRRDGR
Download sequence
Identical sequences K3YM14
Si015290m|PACid:19691758

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]