SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si015339m|PACid:19692414 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si015339m|PACid:19692414
Domain Number 1 Region: 109-245
Classification Level Classification E-value
Superfamily RNI-like 0.0000000000157
Family 28-residue LRR 0.051
Further Details:      
 
Domain Number 2 Region: 8-58
Classification Level Classification E-value
Superfamily F-box domain 0.000000000693
Family F-box domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si015339m|PACid:19692414
Sequence length 297
Sequence
MEASSPRRKPRPAPAEESETSLESLPSEIHERIVSLLPVRYAVRTSAVSRAWRRIWESAP
ASPSIGAMTYADDVLARYSHPVRSFFFHLPEESFQCSDDWVPLLAGKGVQTLRLHFSQGR
DVEPHYMDVSIFSCRELTFLDLIGCDIPAAPAGLVGFPNLTKLYLHGVGFPDNGVRGLEE
LIAESPLLQVLWLDKLWFPEDEDVDEQDGHGFEELVIRAPNLRNLRIVSEYDNGWQIEEL
PCIEKVEISSDNYTTNRDFMRLLTRVARVRELSLKMPKRFSVYHDSDCPSPHLMDFM
Download sequence
Identical sequences K3YM61
Si015339m|PACid:19692414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]