SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si015346m|PACid:19693428 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si015346m|PACid:19693428
Domain Number 1 Region: 28-80
Classification Level Classification E-value
Superfamily F-box domain 0.0000000536
Family F-box domain 0.0096
Further Details:      
 
Domain Number 2 Region: 170-396
Classification Level Classification E-value
Superfamily L domain-like 0.00000122
Family Ngr ectodomain-like 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si015346m|PACid:19693428
Sequence length 477
Sequence
MDAVITRSKRQRLEEESRRQQQRPPPAPRGEEGDAQRLDLIRRLPDDVLGAVITLLPATD
GARTQILSRRWRPLWRSAPLNLEAKNLAAAQAILGSHHGGPGRRFSLTCCSDRTDGYPVI
NDDMLRPPGLDGLQEFCLRLHFSFPIAVALKNGRRNPATAPLSVFRFSATLRVLTIICFD
HGGLEFPAESAAACGTLGFPRLEQLTLSGVSISECTLHGILSRCLVLQSLLLQDNLGYRR
LRISSSTLRSLGVSDLLSRERMLEEVIIEDAPLLASIITDGLTCVRGLKIRVIQAPKLKV
LGYLGDRVNEPMLGSMIFKNMKLVSLPQAMRTVKILALKVASDNLDAVIDFLTWFPCVAK
LHMDVWGKSNNARDLVSLEHLKTLELISYRACTSEVGLIRFFLSNARVLESLKVLADRRV
VCDVDWIPRQHKRLRRIGTAASQGVKICLEPEPIHQPSSYEPMNHVHNLALDDPFGI
Download sequence
Identical sequences K3YM67
Si015346m|PACid:19693428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]